PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_000906-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family WRKY
Protein Properties Length: 538aa    MW: 58493.9 Da    PI: 7.6832
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_000906-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY101.93.7e-32239295259
                    --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
           WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                    dDgynWrKYGqK+vkgsefprsYY+Ct+++C+vkkkve+s  d++v+ei+Y+g+Hnh+
  NNU_000906-RA 239 DDGYNWRKYGQKKVKGSEFPRSYYKCTHHNCSVKKKVECSL-DGQVTEIIYKGQHNHH 295
                    8****************************************.***************7 PP

2WRKY106.31.6e-33424482159
                    ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
           WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                    ldDgy+WrKYGqK+vkg+++prsYY+Ct agC+v+k+ver+++dpk+v++tYeg+Hnh+
  NNU_000906-RA 424 LDDGYRWRKYGQKVVKGNPHPRSYYKCTNAGCNVRKHVERASTDPKAVITTYEGKHNHD 482
                    59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.802.3E-28225297IPR003657WRKY domain
PROSITE profilePS5081122.596233297IPR003657WRKY domain
SuperFamilySSF1182905.89E-25236297IPR003657WRKY domain
SMARTSM007742.2E-35238296IPR003657WRKY domain
PfamPF031062.5E-24239295IPR003657WRKY domain
Gene3DG3DSA:2.20.25.802.6E-37409484IPR003657WRKY domain
SuperFamilySSF1182901.83E-29416484IPR003657WRKY domain
PROSITE profilePS5081138.848419484IPR003657WRKY domain
SMARTSM007741.2E-39424483IPR003657WRKY domain
PfamPF031062.2E-26425482IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009723Biological Processresponse to ethylene
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:1900150Biological Processregulation of defense response to fungus
GO:1900425Biological Processnegative regulation of defense response to bacterium
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 538 aa     Download sequence    Send to blast
MAEKERASKT AAPPRPTIAL PPRSSVESLF TGGAGASPGP MTLVSNFFSD NDPESDCRSF  60
SQLLAGAMAS PVGVAGIRPN FLTDNSTDNS FKENGSGDGC EKDVRLKPHH PLNLVIAHSP  120
MFTIPPGLSP ACLLDSPGLF SPVQGSFGMS HQQALAQVTA QAAQSQSHMY IHGEYASSVP  180
APLPALPSNS MSFGSNATSS QNMPLSTSDP KGNIVESSEI SNSEQRLQPS SIAVDKPSDD  240
GYNWRKYGQK KVKGSEFPRS YYKCTHHNCS VKKKVECSLD GQVTEIIYKG QHNHHPPQPN  300
KRAKEGGNPN AILNAQGNQE FGSQVQSGNS NRPNDNVISS IYRKDQDSSQ VTPEQLSGSS  360
DGEETGDAET KVDKGDDDEP DPKRRQVLHL ITHTEVRVSE VASSHRTVTE PRIIVQTTSE  420
VDLLDDGYRW RKYGQKVVKG NPHPRSYYKC TNAGCNVRKH VERASTDPKA VITTYEGKHN  480
HDVPTAKNSS HNTANSNMPQ PKPLNAVAEK HLLLKNADPR NQDQQPIALL RLKEEKIT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A2e-40239484877Probable WRKY transcription factor 4
2lex_A2e-40239484877Probable WRKY transcription factor 4
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010258724.10.0PREDICTED: probable WRKY transcription factor 4
SwissprotQ9XI901e-172WRKY4_ARATH; Probable WRKY transcription factor 4
TrEMBLF6H5W30.0F6H5W3_VITVI; Putative uncharacterized protein
STRINGVIT_14s0108g01280.t010.0(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G13960.11e-157WRKY DNA-binding protein 4